PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00183.1.g00240.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 606aa    MW: 64030 Da    PI: 8.0135
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00183.1.g00240.1.am.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.78.7e-32326384260
                                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                     +DgynWrKYGqK+vkgse+prsYY+Ct++ C++kkkvers  d++v++i+Y+g Hnh+k
  Zpz_sc00183.1.g00240.1.am.mkhc 326 EDGYNWRKYGQKQVKGSENPRSYYKCTYHCCSMKKKVERSLADGRVTQIVYKGAHNHPK 384
                                     8********************************************************85 PP

2WRKY103.41.2e-32480538159
                                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     ldDg++WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+ +d ++v++tYeg+Hnh+
  Zpz_sc00183.1.g00240.1.am.mkhc 480 LDDGFRWRKYGQKVVKGNPNPRSYYKCTTPGCPVRKHVERACHDSRAVITTYEGKHNHD 538
                                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081126.383320385IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-27322385IPR003657WRKY domain
SuperFamilySSF1182901.31E-24324385IPR003657WRKY domain
SMARTSM007743.9E-34325384IPR003657WRKY domain
PfamPF031061.3E-23326383IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-36465540IPR003657WRKY domain
SuperFamilySSF1182905.36E-29472540IPR003657WRKY domain
PROSITE profilePS5081137.792475540IPR003657WRKY domain
SMARTSM007744.3E-38480539IPR003657WRKY domain
PfamPF031063.2E-25481538IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MGPHGLAFAE SPGLAASADR SNRTSFDAHP MRQCPAPSRK HSSSPTDFEI EECALPASLP  60
ALFPAPTRRY LRRCLATEQP LPSASPLLAC APSSSSPTPS LVSRPPSLVG SPTLLHSSLC  120
SHAMASSTGS LEHGGGGFTF TPPQFITSFT DLLSGAAGDM LSGESPRSMF PRAGGNGGVP  180
KFKSAQPPRL PISPPPMSPS SYFAIPAGLS PAELLDSPVL LTSASNFLAS PTTGAIPAQR  240
FYWKQAADAI AASQQESRAD AGFSDFSFFT AGPDAVPTAQ TASFPSFTKD QQVEQSAAPK  300
VTVSSINKSG GGGGGGGDGG NNKQLEDGYN WRKYGQKQVK GSENPRSYYK CTYHCCSMKK  360
KVERSLADGR VTQIVYKGAH NHPKPLSTRR NSSSGGVGGA ADQDHHHQQA APGTEHAVAT  420
PENSTVTFGD DDGCGSQRSD GDEPDAKRWK EDGENEGSSG GKPVREPRLV VQTLSDIDIL  480
DDGFRWRKYG QKVVKGNPNP RSYYKCTTPG CPVRKHVERA CHDSRAVITT YEGKHNHDVP  540
VGRGAASASR APPAPAPTNH HQQPYTLEML PTSSDAGYGA GGAFQQRAVV AKDEPRDDLF  600
VDSLLC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-36325540877Probable WRKY transcription factor 4
1wj2_A6e-36325540877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570970.0EU957097.1 Zea mays clone 1582655 WRKY53 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962416.10.0PREDICTED: probable WRKY transcription factor 26
TrEMBLK3Z5Y80.0K3Z5Y8_SETIT; Uncharacterized protein
STRINGSi021956m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85333448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.17e-93WRKY DNA-binding protein 26